PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003365G0100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 122aa    MW: 13318.1 Da    PI: 9.5322
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003365G0100genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.87.4e-192155135
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                     C+ Cgtt+Tp+WR gp  +++LCnaCG++yrkk++
  PH01003365G0100 21 CVECGTTTTPMWRGGPTRPRSLCNACGIRYRKKRR 55
                     ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.1E-131565IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.8331551IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-131956No hitNo description
Gene3DG3DSA:3.30.50.102.5E-151956IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.02E-132056No hitNo description
PfamPF003209.1E-172155IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402146IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MGPSDRKVCG IGVVEEGRTS CVECGTTTTP MWRGGPTRPR SLCNACGIRY RKKRRQELGL  60
DQKQQQHHGE ATTEVKDSNS NSSSSSSNLQ VVQKRRLLMG VEEAAFLLMT LSSPPSSTLL  120
HG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0962260.0FP096226.1 Phyllostachys edulis cDNA clone: bphyst038a02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567660.16e-56PREDICTED: GATA transcription factor 23-like
SwissprotQ8LC595e-18GAT23_ARATH; GATA transcription factor 23
TrEMBLA0A0E0JI397e-56A0A0E0JI39_ORYPU; Uncharacterized protein
TrEMBLI1HF657e-56I1HF65_BRADI; Uncharacterized protein
STRINGBRADI2G12590.12e-55(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.19e-18GATA transcription factor 23